Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (10 species) not a true protein |
Species Escherichia coli [TaxId:469008] [255647] (4 PDB entries) |
Domain d1db9a3: 1db9 A:8-137 [302316] Other proteins in same PDB: d1db9a4 automated match to d4i02b1 protein/DNA complex; complexed with cmp |
PDB Entry: 1db9 (more details), 3 Å
SCOPe Domain Sequences for d1db9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1db9a3 b.82.3.2 (A:8-137) automated matches {Escherichia coli [TaxId: 469008]} dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt sekvgnlafl
Timeline for d1db9a3: