Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (5 proteins) |
Protein Lactate dehydrogenase [51859] (11 species) |
Species Dogfish (Squalus acanthias) [TaxId:7797] [51862] (3 PDB entries) |
Domain d6ldh_1: 6ldh 1-160 [30161] Other proteins in same PDB: d6ldh_2 complexed with so4 |
PDB Entry: 6ldh (more details), 2 Å
SCOP Domain Sequences for d6ldh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ldh_1 c.2.1.5 (1-160) Lactate dehydrogenase {Dogfish (Squalus acanthias)} atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi ipnivkhspdciilvvsnpvdvltyvawklsglpmhriig
Timeline for d6ldh_1: