Lineage for d6ldh_1 (6ldh 1-160)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins) Protein Lactate dehydrogenase [51859] (13 species) 
Species Dogfish (Squalus acanthias) [TaxId:7797] [51862] (3 PDB entries) 
Domain d6ldh_1: 6ldh 1-160 [30161]
Other proteins in same PDB: d6ldh_2
complexed with so4
Details for d6ldh_1
PDB Entry: 6ldh (more details), 2 Å
PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase
SCOP Domain Sequences for d6ldh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ldh_1 c.2.1.5 (1-160) Lactate dehydrogenase {Dogfish (Squalus acanthias)}
atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
ipnivkhspdciilvvsnpvdvltyvawklsglpmhriig
SCOP Domain Coordinates for d6ldh_1:
Click to download the PDB-style file with coordinates for d6ldh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6ldh_1:
- d6ldh_1 first appeared (with stable ids) in SCOP 1.55
- d6ldh_1 appears in SCOP 1.65
- d6ldh_1 appears in SCOP 1.69
- d6ldh_1 appears in the current release, SCOPe 2.08, called d6ldha1
View in 3D
