Lineage for d1drwa1 (1drw A:2-130,A:241-273)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2104932Protein Dihydrodipicolinate reductase [51821] (3 species)
  7. 2104933Species Escherichia coli [TaxId:562] [51822] (5 PDB entries)
  8. 2104935Domain d1drwa1: 1drw A:2-130,A:241-273 [30057]
    Other proteins in same PDB: d1drwa2
    complexed with nhd

Details for d1drwa1

PDB Entry: 1drw (more details), 2.2 Å

PDB Description: escherichia coli dhpr/nhdh complex
PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1drwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drwa1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}
hdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvt
vqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadi
aivfaanfsXmtfangavrsalwlsgkesglfdmrdvldlnnl

SCOPe Domain Coordinates for d1drwa1:

Click to download the PDB-style file with coordinates for d1drwa1.
(The format of our PDB-style files is described here.)

Timeline for d1drwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1drwa2