Lineage for d1drwa2 (1drw A:131-240)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203521Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2203563Protein Dihydrodipicolinate reductase [55371] (3 species)
  7. 2203564Species Escherichia coli [TaxId:562] [55372] (5 PDB entries)
  8. 2203566Domain d1drwa2: 1drw A:131-240 [39972]
    Other proteins in same PDB: d1drwa1
    complexed with nhd

Details for d1drwa2

PDB Entry: 1drw (more details), 2.2 Å

PDB Description: escherichia coli dhpr/nhdh complex
PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1drwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drwa2 d.81.1.3 (A:131-240) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}
vgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahaldkdlkdca
vysreghtgervpgtigfatvragdivgehtamfadigerleithkassr

SCOPe Domain Coordinates for d1drwa2:

Click to download the PDB-style file with coordinates for d1drwa2.
(The format of our PDB-style files is described here.)

Timeline for d1drwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1drwa1