SCOPe 2.01: Domain d1ek6b_: 1ek6 B:

Lineage for d1ek6b_ (1ek6 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51754] (7 PDB entries)

8. Domain d1ek6b_: 1ek6 B: [29801]
   complexed with mg, nai, tma, upg

Details for d1ek6b_

PDB Entry: 1ek6, 1.5 Å

PDB Description: structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose

PDB Compounds: (B:) udp-galactose 4-epimerase

SCOPe Domain Sequences for d1ek6b_:

Sequence; same for both SEQRES and ATOM records:

>d1ek6b_ c.2.1.2 (B:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]}
aekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsve
feemdildqgalqrlfkkysfmavihfaglkavgesvqkpldyyrvnltgtiqlleimka
hgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwnav
llryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrdy
ihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarre
gdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgt

Timeline for d1ek6b_:

• d1ek6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ek6b_ appears in SCOP 1.75
  
• d1ek6b_ appears in SCOPe 2.02
  
• d1ek6b_ appears in the current release, SCOPe 2.08