Lineage for d1ek6b_ (1ek6 B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins) 
Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (2 species) Species Human (Homo sapiens) [TaxId:9606] [51754] (2 PDB entries) 
Domain d1ek6b_: 1ek6 B: [29801]
Details for d1ek6b_
PDB Entry: 1ek6 (more details), 1.5 Å
PDB Description: structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose
SCOP Domain Sequences for d1ek6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ek6b_ c.2.1.2 (B:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens)}
aekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsve
feemdildqgalqrlfkkysfmavihfaglkavgesvqkpldyyrvnltgtiqlleimka
hgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwnav
llryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrdy
ihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarre
gdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgt
SCOP Domain Coordinates for d1ek6b_:
Click to download the PDB-style file with coordinates for d1ek6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ek6b_:
- d1ek6b_ appears in SCOP 1.57
- d1ek6b_ appears in the current release, SCOPe 2.08
View in 3D
