Lineage for d1mnsa1 (1mns A:133-359)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) 
binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) 
Protein Mandelate racemase [51617] (3 species) 
Species Pseudomonas putida [TaxId:303] [51618] (6 PDB entries) 
Domain d1mnsa1: 1mns A:133-359 [29246]
Other proteins in same PDB: d1mnsa2
complexed with apg, mg
Details for d1mnsa1
PDB Entry: 1mns (more details), 2 Å
PDB Description: on the role of lysine 166 in the mechanism of mandelate racemase from pseudomonas putida: mechanistic and crystallographic evidence for stereospecific alkylation by (r)-alpha-phenylglycidate
PDB Compounds: (A:) mandelate racemaseSCOPe Domain Sequences for d1mnsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mnsa1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
SCOPe Domain Coordinates for d1mnsa1:
Click to download the PDB-style file with coordinates for d1mnsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mnsa1:
- d1mnsa1 first appeared (with stable ids) in SCOP 1.55, called d1mns_1
- d1mnsa1 appears in SCOPe 2.07
View in 3D
