Lineage for d1mnsa1 (1mns A:133-359)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837014Protein Mandelate racemase [51617] (3 species)
  7. 2837029Species Pseudomonas putida [TaxId:303] [51618] (6 PDB entries)
  8. 2837030Domain d1mnsa1: 1mns A:133-359 [29246]
    Other proteins in same PDB: d1mnsa2
    complexed with apg, mg

Details for d1mnsa1

PDB Entry: 1mns (more details), 2 Å

PDB Description: on the role of lysine 166 in the mechanism of mandelate racemase from pseudomonas putida: mechanistic and crystallographic evidence for stereospecific alkylation by (r)-alpha-phenylglycidate
PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d1mnsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnsa1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

SCOPe Domain Coordinates for d1mnsa1:

Click to download the PDB-style file with coordinates for d1mnsa1.
(The format of our PDB-style files is described here.)

Timeline for d1mnsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mnsa2