SCOPe 2.07: Domain d2xokh1: 2xok H:12-90

Lineage for d2xokh1 (2xok H:12-90)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein automated matches [272490] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311255] (1 PDB entry)

8. Domain d2xokh1: 2xok H:12-90 [290234]
   Other proteins in same PDB: d2xokd1, d2xokd2, d2xokd3, d2xoke1, d2xoke2, d2xoke3, d2xokf1, d2xokf2, d2xokf3, d2xokg_, d2xokh2, d2xoki_
   automated match to d2hldh1
   complexed with anp, mg

Details for d2xokh1

PDB Entry: 2xok, 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution

PDB Compounds: (H:) ATP synthase

SCOPe Domain Sequences for d2xokh1:

Sequence, based on SEQRES records:

>d2xokh1 b.93.1.1 (H:12-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffis
ggfatvqpdsqlcvtaiea

Sequence, based on observed residues (ATOM records):

>d2xokh1 b.93.1.1 (H:12-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisgg
fatvqpdsqlcvtaiea

Timeline for d2xokh1:

• d2xokh1 first appeared in SCOPe 2.06
  
• d2xokh1 appears in the current release, SCOPe 2.08