Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries) |
Domain d2xokf3: 2xok F:358-476 [244563] Other proteins in same PDB: d2xokd1, d2xokd2, d2xoke1, d2xoke2, d2xokf1, d2xokf2, d2xokg_, d2xokh1, d2xokh2, d2xoki_ automated match to d2jdid1 complexed with anp, mg |
PDB Entry: 2xok (more details), 3.01 Å
SCOPe Domain Sequences for d2xokf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xokf3 a.69.1.1 (F:358-476) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaae
Timeline for d2xokf3: