Lineage for d2xokd1 (2xok D:6-82)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408139Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2408210Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2408213Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries)
  8. 2408256Domain d2xokd1: 2xok D:6-82 [244555]
    Other proteins in same PDB: d2xokd2, d2xokd3, d2xoke2, d2xoke3, d2xokf2, d2xokf3, d2xokg_, d2xokh1, d2xokh2, d2xoki_
    automated match to d2jdid2
    complexed with anp, mg

Details for d2xokd1

PDB Entry: 2xok (more details), 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution
PDB Compounds: (D:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2xokd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xokd1 b.49.1.1 (D:6-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
gteglvrgekvldtggp

SCOPe Domain Coordinates for d2xokd1:

Click to download the PDB-style file with coordinates for d2xokd1.
(The format of our PDB-style files is described here.)

Timeline for d2xokd1: