Lineage for d2todb2 (2tod B:44-283)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305533Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 305534Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 305557Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 305563Species Trypanosoma brucei [TaxId:5691] [51426] (3 PDB entries)
  8. 305565Domain d2todb2: 2tod B:44-283 [28652]
    Other proteins in same PDB: d2toda1, d2todb1, d2todc1, d2todd1

Details for d2todb2

PDB Entry: 2tod (more details), 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

SCOP Domain Sequences for d2todb2:

Sequence, based on SEQRES records: (download)

>d2todb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
dlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d2todb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
dlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristlsvkfg
akvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhi
ldigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

SCOP Domain Coordinates for d2todb2:

Click to download the PDB-style file with coordinates for d2todb2.
(The format of our PDB-style files is described here.)

Timeline for d2todb2: