![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (6 proteins) |
![]() | Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
![]() | Species Wild boar (Sus scrofa) [51411] (2 PDB entries) |
![]() | Domain d1h7xa2: 1h7x A:533-844 [28632] Other proteins in same PDB: d1h7xa1, d1h7xa3, d1h7xa4, d1h7xa5, d1h7xb1, d1h7xb3, d1h7xb4, d1h7xb5, d1h7xc1, d1h7xc3, d1h7xc4, d1h7xc5, d1h7xd1, d1h7xd3, d1h7xd4, d1h7xd5 |
PDB Entry: 1h7x (more details), 2.01 Å
SCOP Domain Sequences for d1h7xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7xa2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Wild boar (Sus scrofa)} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlsaphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
Timeline for d1h7xa2:
![]() Domains from same chain: (mouse over for more information) d1h7xa1, d1h7xa3, d1h7xa4, d1h7xa5 |