Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (3 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species) |
Species Wild boar (Sus scrofa) [51912] (2 PDB entries) |
Domain d1h7xb3: 1h7x B:288-440 [30329] Other proteins in same PDB: d1h7xa1, d1h7xa2, d1h7xa4, d1h7xa5, d1h7xb1, d1h7xb2, d1h7xb4, d1h7xb5, d1h7xc1, d1h7xc2, d1h7xc4, d1h7xc5, d1h7xd1, d1h7xd2, d1h7xd4, d1h7xd5 |
PDB Entry: 1h7x (more details), 2.01 Å
SCOP Domain Sequences for d1h7xb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7xb3 c.3.1.1 (B:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Wild boar (Sus scrofa)} pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq fvrteqdetgkwnededqivhlkadvvisafgs
Timeline for d1h7xb3:
View in 3D Domains from same chain: (mouse over for more information) d1h7xb1, d1h7xb2, d1h7xb4, d1h7xb5 |