Lineage for d1h7xa2 (1h7x A:533-844)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64537Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 64538Family c.1.4.1: FMN-linked oxidoreductases [51396] (9 proteins)
  6. 64560Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 64561Species Pig (Sus scrofa) [TaxId:9823] [51411] (2 PDB entries)
  8. 64566Domain d1h7xa2: 1h7x A:533-844 [28632]
    Other proteins in same PDB: d1h7xa1, d1h7xa3, d1h7xa4, d1h7xa5, d1h7xb1, d1h7xb3, d1h7xb4, d1h7xb5, d1h7xc1, d1h7xc3, d1h7xc4, d1h7xc5, d1h7xd1, d1h7xd3, d1h7xd4, d1h7xd5

Details for d1h7xa2

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil

SCOP Domain Sequences for d1h7xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xa2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa)}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlsaphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOP Domain Coordinates for d1h7xa2:

Click to download the PDB-style file with coordinates for d1h7xa2.
(The format of our PDB-style files is described here.)

Timeline for d1h7xa2: