Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein) |
Protein Cytochrome f, small domain [51257] (5 species) |
Species Turnip (Brassica rapa) [TaxId:3711] [51258] (2 PDB entries) |
Domain d1hcza2: 1hcz A:168-230 [28250] Other proteins in same PDB: d1hcza1 complexed with hem |
PDB Entry: 1hcz (more details), 1.96 Å
SCOPe Domain Sequences for d1hcza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcza2 b.84.2.2 (A:168-230) Cytochrome f, small domain {Turnip (Brassica rapa) [TaxId: 3711]} ntvynataggiiskilrkekggyeitivdasnerqvidiiprglellvsegesikldqpl tsn
Timeline for d1hcza2: