Lineage for d1dzrb_ (1dzr B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381160Superfamily b.82.1: RmlC-like cupins [51182] (12 families) (S)
  5. 381161Family b.82.1.1: dTDP-sugar isomerase [51183] (2 proteins)
  6. 381162Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (5 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 381172Species Salmonella typhimurium [TaxId:90371] [51185] (2 PDB entries)
  8. 381174Domain d1dzrb_: 1dzr B: [28077]
    complexed with gol, so4

Details for d1dzrb_

PDB Entry: 1dzr (more details), 2.17 Å

PDB Description: rmlc from salmonella typhimurium

SCOP Domain Sequences for d1dzrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzrb_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium}
mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr
glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah
gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal
lte

SCOP Domain Coordinates for d1dzrb_:

Click to download the PDB-style file with coordinates for d1dzrb_.
(The format of our PDB-style files is described here.)

Timeline for d1dzrb_: