Lineage for d1dzrb_ (1dzr B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies) 
Superfamily b.82.1: RmlC-like [51182] (4 families) 
Family b.82.1.1: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51183] (1 protein) Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (2 species) 
Species Salmonella typhimurium [TaxId:90371] [51185] (2 PDB entries) 
Domain d1dzrb_: 1dzr B: [28077]
Details for d1dzrb_
PDB Entry: 1dzr (more details), 2.17 Å
PDB Description: rmlc from salmonella typhimurium
SCOP Domain Sequences for d1dzrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzrb_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium}
mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr
glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah
gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal
lte
SCOP Domain Coordinates for d1dzrb_:
Click to download the PDB-style file with coordinates for d1dzrb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dzrb_:
- d1dzrb_ appears in SCOP 1.57
- d1dzrb_ appears in the current release, SCOPe 2.08
View in 3D
