Lineage for d4y1ra_ (4y1r A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840330Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1840750Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1840751Protein automated matches [190197] (18 species)
    not a true protein
  7. 1840907Species Staphylococcus aureus [TaxId:158878] [280201] (5 PDB entries)
  8. 1840908Domain d4y1ra_: 4y1r A: [280206]
    automated match to d1oi4a1

Details for d4y1ra_

PDB Entry: 4y1r (more details), 1.65 Å

PDB Description: sav1875-cysteinesulfonic acid
PDB Compounds: (A:) Uncharacterized protein SAV1875

SCOPe Domain Sequences for d4y1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y1ra_ c.23.16.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
tkkvaiilanefedieysspkealenagfntvvigdtansevvgkhgekvtvdvgiaeak
pedydallipggfspdhlrgdtegrygtfakyftkndvptfaichgpqilidtddlkgrt
ltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlql

SCOPe Domain Coordinates for d4y1ra_:

Click to download the PDB-style file with coordinates for d4y1ra_.
(The format of our PDB-style files is described here.)

Timeline for d4y1ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4y1rb_