Lineage for d1oi4a1 (1oi4 A:23-192)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) 
conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structuresFamily c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
contains a catalytic triad or dyad different from the class I GAT triad
Protein Hypothetical protein YhbO [89601] (1 species) Species Escherichia coli [TaxId:562] [89602] (1 PDB entry) 
Domain d1oi4a1: 1oi4 A:23-192 [144364]
structural genomics
Details for d1oi4a1
PDB Entry: 1oi4 (more details), 2.03 Å
PDB Description: crystal structure of yhbo from escherichia coli
PDB Compounds: (A:) hypothetical protein yhboSCOPe Domain Sequences for d1oi4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]}
skkiavlitdefedseftspadefrkaghevitiekqagktvkgkkgeasvtidksidev
tpaefdalllpgghspdylrgdnrfvtftrdfvnsgkpvfaichgpqllisadvirgrkl
tavkpiiidvknagaefydqevvvdkdqlvtsrtpddlpafnrealrllg
SCOPe Domain Coordinates for d1oi4a1:
Click to download the PDB-style file with coordinates for d1oi4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oi4a1:
- d1oi4a1 first appeared in SCOP 1.75
- d1oi4a1 appears in SCOPe 2.04
- d1oi4a1 appears in SCOPe 2.06
- d1oi4a1 appears in the current release, SCOPe 2.08
View in 3D
