![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Coagulation factor VIIa [50550] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50551] (89 PDB entries) Uniprot P08709 213-466 ! Uniprot P08709 213-446 |
![]() | Domain d4zmah_: 4zma H: [280194] Other proteins in same PDB: d4zmal1, d4zmal2, d4zmal3, d4zmat1, d4zmat2 automated match to d4jzeh_ complexed with 0z6, bgc, ca, cac, fuc |
PDB Entry: 4zma (more details), 2.3 Å
SCOPe Domain Sequences for d4zmah_:
Sequence, based on SEQRES records: (download)
>d4zmah_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdceasspgkiteymfcagysdgsk dsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrseprp gvllrapfp
>d4zmah_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdceasgkiteymfcagysdgskds ckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrseprpgv llrapfp
Timeline for d4zmah_: