SCOPe 2.05: Domain d4rx5a_: 4rx5 A:

Lineage for d4rx5a_ (4rx5 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)

8. Domain d4rx5a_: 4rx5 A: [279767]
   automated match to d3gena_
   complexed with 3yo, gol, pg0, so4

Details for d4rx5a_

PDB Entry: 4rx5, 1.36 Å

PDB Description: bruton's tyrosine kinase (btk) with pyridazinone compound 23

PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d4rx5a_:

Sequence; same for both SEQRES and ATOM records:

>d4rx5a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnls
heklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyle
skqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmysk
fssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimysc
whekaderptfkillsnildvmden

Timeline for d4rx5a_:

• d4rx5a_ is new in SCOPe 2.05-stable
  
• d4rx5a_ is called d4rx5a1 in SCOPe 2.06
  
• d4rx5a_ appears in the current release, SCOPe 2.08, called d4rx5a1