SCOPe 2.05: Domain d5d82a_: 5d82 A:

Lineage for d5d82a_ (5d82 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (41 PDB entries)
   Uniprot P07445

8. Domain d5d82a_: 5d82 A: [279697]
   automated match to d3t8nf_

Details for d5d82a_

PDB Entry: 5d82, 1.37 Å

PDB Description: crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y16(cl-y)

PDB Compounds: (A:) Delta(5)-3-ketosteroid isomerase

SCOPe Domain Sequences for d5d82a_:

Sequence; same for both SEQRES and ATOM records:

>d5d82a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Timeline for d5d82a_:

• d5d82a_ is new in SCOPe 2.05-stable
  
• d5d82a_ appears in SCOPe 2.06
  
• d5d82a_ appears in the current release, SCOPe 2.08