Lineage for d5d82a_ (5d82 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936379Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2936380Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)
  7. 2936462Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
    Uniprot P07445
  8. 2936505Domain d5d82a_: 5d82 A: [279697]
    automated match to d3t8nf_

Details for d5d82a_

PDB Entry: 5d82 (more details), 1.37 Å

PDB Description: crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y16(cl-y)
PDB Compounds: (A:) Delta(5)-3-ketosteroid isomerase

SCOPe Domain Sequences for d5d82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d82a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

SCOPe Domain Coordinates for d5d82a_:

Click to download the PDB-style file with coordinates for d5d82a_.
(The format of our PDB-style files is described here.)

Timeline for d5d82a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5d82b_