Lineage for d5dw0b_ (5dw0 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157154Protein automated matches [190054] (13 species)
    not a true protein
  7. 2157183Species Pyrococcus furiosus [TaxId:186497] [279274] (6 PDB entries)
  8. 2157201Domain d5dw0b_: 5dw0 B: [279278]
    automated match to d1v8zb_
    complexed with na, pls

Details for d5dw0b_

PDB Entry: 5dw0 (more details), 2.01 Å

PDB Description: trpb from pyrococcus furiosus with l-serine bound as the external aldimine
PDB Compounds: (B:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5dw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dw0b_ c.79.1.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d5dw0b_:

Click to download the PDB-style file with coordinates for d5dw0b_.
(The format of our PDB-style files is described here.)

Timeline for d5dw0b_: