SCOPe 2.07: Domain d4ylcc1: 4ylc C:1-115

Lineage for d4ylcc1 (4ylc C:1-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (9 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries)

8. Domain d4ylcc1: 4ylc C:1-115 [279057]
   Other proteins in same PDB: d4ylca2, d4ylcb2, d4ylcc2, d4ylcd2, d4ylce2, d4ylcf2, d4ylcg2, d4ylch2
   automated match to d3aaca_
   complexed with cl; mutant

Details for d4ylcc1

PDB Entry: 4ylc, 3.1 Å

PDB Description: crystal structure of del-c4 mutant of hsp14.1 from sulfolobus solfatataricus p2

PDB Compounds: (C:) Heat shock protein Hsp20

SCOPe Domain Sequences for d4ylcc1:

Sequence, based on SEQRES records:

>d4ylcc1 b.15.1.0 (C:1-115) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
mmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqne
liinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtakyengvltiripv

Sequence, based on observed residues (ATOM records):

>d4ylcc1 b.15.1.0 (C:1-115) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
mmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqne
liinaereiqyigtkyatqrplkihkvirlpvkvtakyengvltiripv

Timeline for d4ylcc1:

• d4ylcc1 first appeared in SCOPe 2.05, called d4ylcc_
  
• d4ylcc1 appears in SCOPe 2.06
  
• d4ylcc1 appears in the current release, SCOPe 2.08