Lineage for d3aaca_ (3aac A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-keySuperfamily b.15.1: HSP20-like chaperones [49764] (5 families) 
Family b.15.1.0: automated matches [191643] (1 protein)
not a true familyProtein automated matches [191181] (9 species)
not a true protein
Species Sulfolobus tokodaii [TaxId:273063] [226008] (3 PDB entries) 
Domain d3aaca_: 3aac A: [208182]
automated match to d1shsa_
mutant
Details for d3aaca_
PDB Entry: 3aac (more details), 2.4 Å
PDB Description: small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form ii crystal
PDB Compounds: (A:) Putative uncharacterized protein ST1653SCOPe Domain Sequences for d3aaca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aaca_ b.15.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
myylgkelqkrseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqnel
iieaereitepgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripiagtsvf
kfe
SCOPe Domain Coordinates for d3aaca_:
Click to download the PDB-style file with coordinates for d3aaca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3aaca_:
- d3aaca_ first appeared in SCOPe 2.03
- d3aaca_ appears in SCOPe 2.06
- d3aaca_ appears in the current release, SCOPe 2.08
View in 3D
