Lineage for d4ylcd1 (4ylc D:1-115)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383524Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2383525Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2383628Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2383629Protein automated matches [191181] (9 species)
    not a true protein
  7. 2383645Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries)
  8. 2383657Domain d4ylcd1: 4ylc D:1-115 [279055]
    Other proteins in same PDB: d4ylca2, d4ylcb2, d4ylcc2, d4ylcd2, d4ylce2, d4ylcf2, d4ylcg2, d4ylch2
    automated match to d3aaca_
    complexed with cl; mutant

Details for d4ylcd1

PDB Entry: 4ylc (more details), 3.1 Å

PDB Description: crystal structure of del-c4 mutant of hsp14.1 from sulfolobus solfatataricus p2
PDB Compounds: (D:) Heat shock protein Hsp20

SCOPe Domain Sequences for d4ylcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ylcd1 b.15.1.0 (D:1-115) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
mmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqne
liinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtakyengvltiripv

SCOPe Domain Coordinates for d4ylcd1:

Click to download the PDB-style file with coordinates for d4ylcd1.
(The format of our PDB-style files is described here.)

Timeline for d4ylcd1: