SCOPe 2.05: Domain d5d9ma_: 5d9m A:

Lineage for d5d9ma_ (5d9m A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Prevotella bryantii [TaxId:77095] [276992] (5 PDB entries)

8. Domain d5d9ma_: 5d9m A: [278949]
   automated match to d4im4a_
   complexed with bgc, glc, xys; mutant

Details for d5d9ma_

PDB Entry: 5d9m, 1.9 Å

PDB Description: crystal structure of pbgh5a, a glycoside hydrolase family 5 enzyme from prevotella bryantii b14, e280a mutant in complex with the xyloglucan tetradecasaccharide xxxgxxxg

PDB Compounds: (A:) B-1,4-endoglucanase

SCOPe Domain Sequences for d5d9ma_:

Sequence; same for both SEQRES and ATOM records:

>d5d9ma_ c.1.8.0 (A:) automated matches {Prevotella bryantii [TaxId: 77095]}
tymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngf
navripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikad
tdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnnya
qdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnff
ntkttwdsechntlteifsalskkfttipyiigaygthgesdisvsksspaekiklaadq
aadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeayn

Timeline for d5d9ma_:

• d5d9ma_ is new in SCOPe 2.05-stable
  
• d5d9ma_ appears in SCOPe 2.06
  
• d5d9ma_ appears in the current release, SCOPe 2.08