SCOPe 2.06: Domain d5c7xn1: 5c7x N:1-108

Lineage for d5c7xn1 (5c7x N:1-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5c7xn1: 5c7x N:1-108 [278049]
   Other proteins in same PDB: d5c7xa1, d5c7xa2, d5c7xb1, d5c7xb2
   automated match to d3s96d1
   complexed with peg, pg6, pge

Details for d5c7xn1

PDB Entry: 5c7x, 2.95 Å

PDB Description: crystal structure of mor04357, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf

PDB Compounds: (N:) Immunglobulin G1 Fab fragment, light chain

SCOPe Domain Sequences for d5c7xn1:

Sequence, based on SEQRES records:

>d5c7xn1 b.1.1.0 (N:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dieltqppsvsvapgqtariscsgdsigkkyaywyqqkpgqapvlviykkrpsgiperfs
gsnsgntatltisgtqaedeadyycsawgdkgmvfgggtkltvlgq

Sequence, based on observed residues (ATOM records):

>d5c7xn1 b.1.1.0 (N:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dieltqppsvsvapgqtariscsgdsigkkyaywyqqkpgqapvlviykkrerfsgsnsg
ntatltisgtqaedeadyycsawgdkgmvfgggtkltvlgq

Timeline for d5c7xn1:

• d5c7xn1 first appeared in SCOPe 2.05
  
• d5c7xn1 appears in SCOPe 2.07
  
• d5c7xn1 appears in the current release, SCOPe 2.08