Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries) |
Domain d5c7xn1: 5c7x N:1-108 [278049] Other proteins in same PDB: d5c7xa_, d5c7xb_ automated match to d3s96d1 complexed with peg, pg6, pge |
PDB Entry: 5c7x (more details), 2.95 Å
SCOPe Domain Sequences for d5c7xn1:
Sequence, based on SEQRES records: (download)
>d5c7xn1 b.1.1.0 (N:1-108) automated matches {Homo sapiens [TaxId: 9606]} dieltqppsvsvapgqtariscsgdsigkkyaywyqqkpgqapvlviykkrpsgiperfs gsnsgntatltisgtqaedeadyycsawgdkgmvfgggtkltvlgq
>d5c7xn1 b.1.1.0 (N:1-108) automated matches {Homo sapiens [TaxId: 9606]} dieltqppsvsvapgqtariscsgdsigkkyaywyqqkpgqapvlviykkrerfsgsnsg ntatltisgtqaedeadyycsawgdkgmvfgggtkltvlgq
Timeline for d5c7xn1:
View in 3D Domains from other chains: (mouse over for more information) d5c7xa_, d5c7xb_, d5c7xl1, d5c7xl2 |