![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
![]() | Domain d5c7xl1: 5c7x L:1-108 [278047] Other proteins in same PDB: d5c7xa1, d5c7xa2, d5c7xb1, d5c7xb2 automated match to d3s96d1 complexed with peg, pg6, pge |
PDB Entry: 5c7x (more details), 2.95 Å
SCOPe Domain Sequences for d5c7xl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c7xl1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]} dieltqppsvsvapgqtariscsgdsigkkyaywyqqkpgqapvlviykkrpsgiperfs gsnsgntatltisgtqaedeadyycsawgdkgmvfgggtkltvlgq
Timeline for d5c7xl1: