SCOPe 2.07: Domain d5c7xa1: 5c7x A:9-110

Lineage for d5c7xa1 (5c7x A:9-110)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47290] (8 PDB entries)

8. Domain d5c7xa1: 5c7x A:9-110 [278026]
   Other proteins in same PDB: d5c7xa2, d5c7xb2, d5c7xl1, d5c7xl2, d5c7xn1, d5c7xn2
   automated match to d2gmfa_
   complexed with peg, pg6, pge

Details for d5c7xa1

PDB Entry: 5c7x, 2.95 Å

PDB Description: crystal structure of mor04357, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf

PDB Compounds: (A:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5c7xa1:

Sequence, based on SEQRES records:

>d5c7xa1 a.26.1.2 (A:9-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
stqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrg
sltklkgpltmmashykqhcpptpetscatqiitfesfkenl

Sequence, based on observed residues (ATOM records):

>d5c7xa1 a.26.1.2 (A:9-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
stqpwehvnaiqearrllnlsrtaaemnetvevisemfdlqeptclqtrlelykqglrgs
ltklkgpltmmashykqhcpptpetscatqiitfesfkenl

Timeline for d5c7xa1:

• d5c7xa1 first appeared in SCOPe 2.05, called d5c7xa_
  
• d5c7xa1 appears in SCOPe 2.06
  
• d5c7xa1 appears in the current release, SCOPe 2.08