![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47290] (8 PDB entries) |
![]() | Domain d5c7xa1: 5c7x A:9-110 [278026] Other proteins in same PDB: d5c7xa2, d5c7xb2, d5c7xl1, d5c7xl2, d5c7xn1, d5c7xn2 automated match to d2gmfa_ complexed with peg, pg6, pge |
PDB Entry: 5c7x (more details), 2.95 Å
SCOPe Domain Sequences for d5c7xa1:
Sequence, based on SEQRES records: (download)
>d5c7xa1 a.26.1.2 (A:9-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]} stqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrg sltklkgpltmmashykqhcpptpetscatqiitfesfkenl
>d5c7xa1 a.26.1.2 (A:9-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]} stqpwehvnaiqearrllnlsrtaaemnetvevisemfdlqeptclqtrlelykqglrgs ltklkgpltmmashykqhcpptpetscatqiitfesfkenl
Timeline for d5c7xa1: