![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
![]() | Domain d3s96d1: 3s96 D:242-357 [216254] automated match to d1q1jl1 |
PDB Entry: 3s96 (more details), 1.9 Å
SCOPe Domain Sequences for d3s96d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s96d1 b.1.1.0 (D:242-357) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lvltqsssasfslgasakltctlnsqhstytiewyqqqplkppkyvmelkkdgshstgdg ipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgq
Timeline for d3s96d1: