Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily) alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325 |
Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) |
Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins) automatically mapped to Pfam PF08724 |
Protein automated matches [277252] (2 species) not a true protein |
Species Adeno-associated virus 2 [TaxId:10804] [277253] (1 PDB entry) |
Domain d5dcxc_: 5dcx C: [277255] Other proteins in same PDB: d5dcxa2, d5dcxb2 automated match to d1uuta_ complexed with mg |
PDB Entry: 5dcx (more details), 2.6 Å
SCOPe Domain Sequences for d5dcxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dcxc_ d.89.1.3 (C:) automated matches {Adeno-associated virus 2 [TaxId: 10804]} mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri yrgieptlpnwfavtktrngagggnkvvdesyipnyllpktqpelqwawtnmeqylsacl nlterkrlvaqhlthvsqtqeq
Timeline for d5dcxc_: