Lineage for d5dcxb1 (5dcx B:1-209)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204604Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2204605Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2204652Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
    automatically mapped to Pfam PF08724
  6. 2204664Protein automated matches [277252] (2 species)
    not a true protein
  7. 2204669Species Adeno-associated virus 2 [TaxId:10804] [277253] (1 PDB entry)
  8. 2204671Domain d5dcxb1: 5dcx B:1-209 [277254]
    Other proteins in same PDB: d5dcxa2, d5dcxb2
    automated match to d1uuta_
    complexed with mg

Details for d5dcxb1

PDB Entry: 5dcx (more details), 2.6 Å

PDB Description: structural studies of aav2 rep68 reveal a partially structured linker and compact domain conformation
PDB Compounds: (B:) Protein Rep68

SCOPe Domain Sequences for d5dcxb1:

Sequence, based on SEQRES records: (download)

>d5dcxb1 d.89.1.3 (B:1-209) automated matches {Adeno-associated virus 2 [TaxId: 10804]}
mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktrngagggnkvvdesyipnyllpktqpelqwawtnmeqylsacl
nlterkrlvaqhlthvsqtqeqnkenqnp

Sequence, based on observed residues (ATOM records): (download)

>d5dcxb1 d.89.1.3 (B:1-209) automated matches {Adeno-associated virus 2 [TaxId: 10804]}
mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktggnkvvdesyipnyllpktqpelqwawtnmeqylsaclnlter
krlvaqhlthvsqtqeqnkenqnp

SCOPe Domain Coordinates for d5dcxb1:

Click to download the PDB-style file with coordinates for d5dcxb1.
(The format of our PDB-style files is described here.)

Timeline for d5dcxb1: