Class b: All beta proteins [48724] (180 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
Domain d5cu5a1: 5cu5 A:54-271 [277106] Other proteins in same PDB: d5cu5a2, d5cu5a3, d5cu5a4, d5cu5a5, d5cu5b2, d5cu5b3, d5cu5b4, d5cu5b5 automated match to d3se6a1 complexed with nag |
PDB Entry: 5cu5 (more details), 3.02 Å
SCOPe Domain Sequences for d5cu5a1:
Sequence, based on SEQRES records: (download)
>d5cu5a1 b.98.1.0 (A:54-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhsk dleitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklg dgfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhial snmpkvktielegglledhfettvkmstylvayivcdf
>d5cu5a1 b.98.1.0 (A:54-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhsk dleitnatlqseeymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgf egfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnm pkvktielegglledhfettvkmstylvayivcdf
Timeline for d5cu5a1: