Lineage for d4yw7o_ (4yw7 O:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774647Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 2774648Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 2774649Species Pseudomonas aeruginosa [TaxId:287] [82024] (21 PDB entries)
  8. 2774707Domain d4yw7o_: 4yw7 O: [276860]
    automated match to d1l7la_
    complexed with 4j0, ca, gal

Details for d4yw7o_

PDB Entry: 4yw7 (more details), 1.82 Å

PDB Description: structural insight into divalent galactoside binding to pseudomonas aeruginosa lectin leca
PDB Compounds: (O:) PA-I galactophilic lectin

SCOPe Domain Sequences for d4yw7o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yw7o_ b.18.1.16 (O:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOPe Domain Coordinates for d4yw7o_:

Click to download the PDB-style file with coordinates for d4yw7o_.
(The format of our PDB-style files is described here.)

Timeline for d4yw7o_: