Lineage for d4r6ea2 (4r6e A:797-1010)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606665Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2606666Protein automated matches [191197] (12 species)
    not a true protein
  7. 2606733Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)
  8. 2606791Domain d4r6ea2: 4r6e A:797-1010 [276726]
    Other proteins in same PDB: d4r6ea1, d4r6eb1, d4r6ec1, d4r6ed1
    automated match to d4hhyd2
    protein/DNA complex; complexed with 3jd, gol, so4

Details for d4r6ea2

PDB Entry: 4r6e (more details), 2.2 Å

PDB Description: human artd1 (parp1) - catalytic domain in complex with inhibitor niraparib
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4r6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r6ea2 d.166.1.0 (A:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

SCOPe Domain Coordinates for d4r6ea2:

Click to download the PDB-style file with coordinates for d4r6ea2.
(The format of our PDB-style files is described here.)

Timeline for d4r6ea2: