Class a: All alpha proteins [46456] (289 folds) |
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
Protein automated matches [226964] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries) |
Domain d4r6ed1: 4r6e D:663-796 [276723] Other proteins in same PDB: d4r6ea2, d4r6eb2, d4r6ec2, d4r6ed2 automated match to d4hhyd1 protein/DNA complex; complexed with 3jd, gol, so4 |
PDB Entry: 4r6e (more details), 2.2 Å
SCOPe Domain Sequences for d4r6ed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r6ed1 a.41.1.0 (D:663-796) automated matches {Human (Homo sapiens) [TaxId: 9606]} sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq gssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs ddsskdpidvnyek
Timeline for d4r6ed1: