Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries) |
Domain d4r6ea2: 4r6e A:797-1010 [276726] Other proteins in same PDB: d4r6ea1, d4r6eb1, d4r6ec1, d4r6ed1 automated match to d4hhyd2 protein/DNA complex; complexed with 3jd, gol, so4 |
PDB Entry: 4r6e (more details), 2.2 Å
SCOPe Domain Sequences for d4r6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r6ea2 d.166.1.0 (A:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfk
Timeline for d4r6ea2: