Lineage for d4r6eb2 (4r6e B:797-1011)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939878Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1939879Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1940165Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 1940166Protein automated matches [191197] (7 species)
    not a true protein
  7. 1940202Species Human (Homo sapiens) [TaxId:9606] [225406] (26 PDB entries)
  8. 1940237Domain d4r6eb2: 4r6e B:797-1011 [276722]
    Other proteins in same PDB: d4r6ea1, d4r6eb1, d4r6ec1, d4r6ed1
    automated match to d4hhyd2
    protein/DNA complex; complexed with 3jd, gol, so4

Details for d4r6eb2

PDB Entry: 4r6e (more details), 2.2 Å

PDB Description: human artd1 (parp1) - catalytic domain in complex with inhibitor niraparib
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4r6eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r6eb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d4r6eb2:

Click to download the PDB-style file with coordinates for d4r6eb2.
(The format of our PDB-style files is described here.)

Timeline for d4r6eb2: