SCOPe 2.05: Domain d4r6ea1: 4r6e A:661-796

Lineage for d4r6ea1 (4r6e A:661-796)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (32 PDB entries)

8. Domain d4r6ea1: 4r6e A:661-796 [276725]
   Other proteins in same PDB: d4r6ea2, d4r6eb2, d4r6ec2, d4r6ed2
   automated match to d4hhyd1
   protein/DNA complex; complexed with 3jd, gol, so4

Details for d4r6ea1

PDB Entry: 4r6e, 2.2 Å

PDB Description: human artd1 (parp1) - catalytic domain in complex with inhibitor niraparib

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4r6ea1:

Sequence; same for both SEQRES and ATOM records:

>d4r6ea1 a.41.1.0 (A:661-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav
sqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrg
gsddsskdpidvnyek

Timeline for d4r6ea1:

• d4r6ea1 is new in SCOPe 2.05-stable
  
• d4r6ea1 appears in SCOPe 2.06
  
• d4r6ea1 appears in the current release, SCOPe 2.08