Class b: All beta proteins [48724] (141 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40-repeat [50978] (1 family) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (7 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [50981] (9 PDB entries) |
Domain d1gotb_: 1got B: [27648] Other proteins in same PDB: d1gota1, d1gota2, d1gotg_ complexed with gdp |
PDB Entry: 1got (more details), 2 Å
SCOP Domain Sequences for d1gotb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gotb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)} seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk adragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d1gotb_: