SCOP 1.67: Domain d1gota2: 1got A:6-60,A:182-343

Lineage for d1gota2 (1got A:6-60,A:182-343)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (2 species)
   common fold is interrupted with an all-alpha domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (18 PDB entries)

8. Domain d1gota2: 1got A:6-60,A:182-343 [32096]
   Other proteins in same PDB: d1gota1, d1gotb_, d1gotg_
   species chimera
   complexed with gdp

Details for d1gota2

PDB Entry: 1got, 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits

SCOP Domain Sequences for d1gota2:

Sequence; same for both SEQRES and ATOM records:

>d1gota2 c.37.1.8 (A:6-60,A:182-343) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
saeekhsrelekklkedaekdartvkllllgagesgkstivkqmkiihqdgysleXetqf
sfkdlnfrmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl
fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeagnyikvqfle
lnmrrdvkeiyshmtcatdtqnvkfvfdavtdiiiken

Timeline for d1gota2:

• d1gota2 first appeared (with stable ids) in SCOP 1.55
  
• d1gota2 appears in SCOP 1.65
  
• d1gota2 appears in SCOP 1.69
  
• d1gota2 appears in the current release, SCOPe 2.08