Lineage for d4r8wl_ (4r8w L:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765151Domain d4r8wl_: 4r8w L: [276355]
    Other proteins in same PDB: d4r8wa_, d4r8wb_
    automated match to d1kxtb_
    complexed with nag

Details for d4r8wl_

PDB Entry: 4r8w (more details), 2.79 Å

PDB Description: crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
PDB Compounds: (L:) Light chain of neutralizing antibody CT149

SCOPe Domain Sequences for d4r8wl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r8wl_ b.1.1.0 (L:) automated matches {Homo sapiens [TaxId: 9606]}
evvltqspgtlalppgeratlscrashrvgstyiawyqqksgqaprrliygasnratdip
drfsgsgsgtdftltirrlepedsavyycqqfsvspwtfgqgtrveikrt

SCOPe Domain Coordinates for d4r8wl_:

Click to download the PDB-style file with coordinates for d4r8wl_.
(The format of our PDB-style files is described here.)

Timeline for d4r8wl_: