Lineage for d1kxtb_ (1kxt B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755462Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1755463Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 1755482Domain d1kxtb_: 1kxt B: [73179]
    Other proteins in same PDB: d1kxta1, d1kxta2, d1kxtc1, d1kxtc2, d1kxte1, d1kxte2
    VHh against alpha-amylase
    complexed with ca, cl

Details for d1kxtb_

PDB Entry: 1kxt (more details), 2 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase
PDB Compounds: (B:) immunoglobulin vhh fragment

SCOPe Domain Sequences for d1kxtb_:

Sequence, based on SEQRES records: (download)

>d1kxtb_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya
dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg
tqvtv

Sequence, based on observed residues (ATOM records): (download)

>d1kxtb_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvasgggsvqaggslrlscaastfssypmgwyrqapgkecelsarifsdgsanyads
vkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqgtq
vtv

SCOPe Domain Coordinates for d1kxtb_:

Click to download the PDB-style file with coordinates for d1kxtb_.
(The format of our PDB-style files is described here.)

Timeline for d1kxtb_: