SCOPe 2.08: Domain d4raga1: 4rag A:2-296

Lineage for d4raga1 (4rag A:2-296)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.219: PP2C-like [81607] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; antiparallel beta sheets

4. Superfamily d.219.1: PP2C-like [81606] (2 families)
   contain binuclear metal (Mn) centre

5. Family d.219.1.1: PP2C-like [81605] (3 proteins)
   Pfam PF00481

6. Protein automated matches [232201] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232202] (8 PDB entries)

8. Domain d4raga1: 4rag A:2-296 [276342]
   Other proteins in same PDB: d4raga2
   automated match to d1a6qa2
   complexed with mn

Details for d4raga1

PDB Entry: 4rag, 1.85 Å

PDB Description: crystal structure of ppc2a-d38k

PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d4raga1:

Sequence; same for both SEQRES and ATOM records:

>d4raga1 d.219.1.1 (A:2-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gafldkpkmekhnaqgqgnglryglssmqgwrvemekahtaviglpsgleswsffavydg
hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapk

Timeline for d4raga1:

• d4raga1 first appeared in SCOPe 2.05
  
• d4raga1 appears in SCOPe 2.07