PDB entry 4rag

View 4rag on RCSB PDB site
Description: CRYSTAL STRUCTURE of PPC2A-D38K
Class: metal binding protein
Keywords: serine/threonine phosphatase, PP2C family, phosphatation, METAL BINDING PROTEIN
Deposited on 2014-09-10, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein phosphatase 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPM1A, PPPM1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35813 (0-366)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d4raga1, d4raga2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ragA (A:)
    gafldkpkmekhnaqgqgnglryglssmqgwrvemekahtaviglpsgleswsffavydg
    hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
    adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
    vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
    wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspea
    vkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrnvieav
    ynrlnpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ragA (A:)
    gafldkpkmekhnaqgqgnglryglssmqgwrvemekahtaviglpsgleswsffavydg
    hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
    adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
    vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
    wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspea
    vkkeaeldkylecrveeiikvpdlvhvmrtlasenipslppggelaskrnvieavynrln
    py