SCOPe 2.06: Domain d5cfna1: 5cfn A:193-372

Lineage for d5cfna1 (5cfn A:193-372)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.0: automated matches [276281] (1 protein)
   not a true family

6. Protein automated matches [276282] (1 species)
   not a true protein

7. Species Nematostella vectensis [TaxId:45351] [276284] (7 PDB entries)

8. Domain d5cfna1: 5cfn A:193-372 [276296]
   Other proteins in same PDB: d5cfna2, d5cfnb2
   automated match to d4f5da_
   complexed with 2ba

Details for d5cfna1

PDB Entry: 5cfn, 2.95 Å

PDB Description: crystal structure of anemone sting (nematostella vectensis) in complex with 3',3' c-di-amp, c[a(3',5')pa(3',5')p]

PDB Compounds: (A:) Stimulator of Interferon Genes

SCOPe Domain Sequences for d5cfna1:

Sequence; same for both SEQRES and ATOM records:

>d5cfna1 d.387.1.0 (A:193-372) automated matches {Nematostella vectensis [TaxId: 45351]}
nvadglawsyyfgylkfvlpelekqiektskfrskekfvkkmfilipsncfwddkipgsd
ydpqnritfegnteplektrggvflrhykhsvyeikdgenepwfcimeyatplltlydms
vaqpgelsreerdaqvvvflrklqdilegdracqgkyelvtfspdrdladvmlrklkdse

Timeline for d5cfna1:

• d5cfna1 first appeared in SCOPe 2.05, called d5cfna_
  
• d5cfna1 appears in SCOPe 2.07
  
• d5cfna1 appears in the current release, SCOPe 2.08